SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954614|ref|YP_730241.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954614|ref|YP_730241.1|
Domain Number 1 Region: 46-312
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.21e-74
Family Alanine racemase-like, N-terminal domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 284-447
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.38e-49
Family Eukaryotic ODC-like 0.0000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954614|ref|YP_730241.1|
Sequence length 453
Comment diaminopimelate decarboxylase [Synechococcus sp. CC9311]
Sequence
MATPYESGCDHVSPNRNLAPVSAELDDLGRLMVGGCRLSELAERYGTPLYVLDEVTIRAS
AQEYREALKRHYPGDSLAVYASKAHSSLALTGLVASEGLGLDAVSAGELLTALDGGMPPE
RMVLHGNNKSVEELALAYSHGVMVVADNQHDLDCLAELVPQGGGPVRLMLRFTPGIECHT
HEYIRTGHLDSKFGFDPDQLQPVLTALAGCAWARVEGLHAHIGSQIFELDPHRDLAAVMA
DALKLARELGHPVRDLNVGGGLGIRYVESDDPPSIDAWVKVVAEAVTLACRERGLELPRL
MCEPGRSLVASSGVTVYTVGARKVVPGIRTYVSVDGGMSDNPRPITYQSLYTACLADRPL
AQADETITLAGKHCESGDVLLKDLSFPSCRSGEVLVVLATGAYNLSMSSNYNRIPRPAAV
LVNQGEAELIQRREQPEDLLRYDLMPDRLRSVK
Download sequence
Identical sequences Q0IBD1
gi|113954614|ref|YP_730241.1| WP_011618963.1.57161 64471.sync_1029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]