SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954698|ref|YP_731090.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954698|ref|YP_731090.1|
Domain Number 1 Region: 180-641
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.25e-118
Family Amylase, catalytic domain 0.00000000362
Further Details:      
 
Domain Number 2 Region: 648-750
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.56e-34
Family alpha-Amylases, C-terminal beta-sheet domain 0.00028
Further Details:      
 
Domain Number 3 Region: 18-115
Classification Level Classification E-value
Superfamily E set domains 1.46e-20
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 
Domain Number 4 Region: 139-200
Classification Level Classification E-value
Superfamily E set domains 0.0000000812
Family E-set domains of sugar-utilizing enzymes 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954698|ref|YP_731090.1|
Sequence length 765
Comment glycogen branching enzyme [Synechococcus sp. CC9311]
Sequence
MTSAVLDWMVQDSRRLAECRHDHPFSLLGPQQLESGQWVVRAWVPEAETVELILDGERLS
MQTPHHPWVFEAECSRDPGHHYKLQIRRGGIEHEQFDPWAFRHEWMGEMDRHLFAEGNHH
HIWRRMGAHRCQQGGIQGVMFCLWAPNALTVSVIGNLNSWDGRYHPMQQRLGGIWELFVP
ELEEGHFYKYEIRTQDGHCYQKADPYGFQHEVRPDTSSIVSHLDGFQWNDDAWINSRDRR
NPLDQPISVYEMHLGSWIHASADDPFIEADGTPRPPVPAADLKPGARLLTYPELADRLIP
YVKEQGFSHIELMPITEHPFDGSWGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVII
DWVPGHFPKDSHGLAFFDGCHLYEHADPRIGEHKEWGTLIFNYSRNEVRNFLVANLVFWF
DQFHIDGIRVDAVASMLYRDYLRPDGEWLANEHGGRENTEAVRFLQQANHVLFEHFPGAL
SIAEESTTWPMVTQPTENGGLGFNLKWNMGWMHDMLDYFELDPWFRQFHQNNITFSIWYT
YTENFMLALSHDEVVHGKSHLLHKMPGDDWQKYANTRALLAYMWTHPGKKTIFMGMEFGQ
RAEWNVWGDLQWDLLNYEPHAGVHRMVKELNALYKQEPALWQDDFDQYGFQWIDCNDNRH
SVISFMRRESTSGSWLVVVANFTPQSHSHYKVGVPISGFYEEIFNTDAAKYGGSNLGNLG
GKPSDEWGIHGYENSLDLCLPPLSLMVFKHDPKKSLAEVTNKERA
Download sequence
Identical sequences Q0I8Y2
gi|113954698|ref|YP_731090.1| WP_011619803.1.57161 64471.sync_1886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]