SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954846|ref|YP_729690.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954846|ref|YP_729690.1|
Domain Number 1 Region: 19-502
Classification Level Classification E-value
Superfamily ADC synthase 1.06e-146
Family ADC synthase 0.000000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954846|ref|YP_729690.1|
Sequence length 510
Comment anthranilate synthase component I [Synechococcus sp. CC9311]
Sequence
MLSPDRSAFLEAARCGATFIPVAHSWPADLETPLTTWLKVGEGHPPGVLLESVEGGENLG
RWSVIACDPLWTLSARGDVLTRRWRDGYEESFQGNPLEVLRECTNAYRPVSLPGLPPLGQ
LYGMWGYELIRWIEPSVPVHKADENAPPDGVWMLMDSILIIDQVKRLITAVAYGDLSNTR
AAAKSADQAWDGAMGRILGLENRMASPLPQVRPLRWKPAARPTPETESNRSPENYQEAVA
TAQEHIAAGDAFQLVISQRLETRVSQPPLEVYRSLRMVNPSPYMAFFDFGDWYLIGSSPE
VMVKAEPDQGGIRASLRPIAGTRPRGRNELEDRNFEVDLLADPKERAEHVMLVDLGRNDL
GRVCTAGTVDVKELMVIERYSHVMHIVSQVEGRLAQGRDIWDLLMASFPAGTVSGAPKIR
AMQLIHQLEPDARGPYSGVYGSVDLAGALNTAITIRTMVVRPHPEGGWNIQVQAGAGVVA
DSDPASEYQETLNKARAMLTALACLEDPKS
Download sequence
Identical sequences Q0ICY2
WP_011618422.1.57161 gi|113954846|ref|YP_729690.1| 64471.sync_0462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]