SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954886|ref|YP_730130.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954886|ref|YP_730130.1|
Domain Number 1 Region: 295-468
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.22e-69
Family Transhydrogenase domain III (dIII) 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954886|ref|YP_730130.1|
Sequence length 474
Comment NAD/NADP transhydrogenase subunit beta [Synechococcus sp. CC9311]
Sequence
MSTAVVVKYAIDLVAVLLLALGIKGLSKVRSAREANRLAAVAMALAVLGVLVDSFAGGIS
ASAWTWIIGGTIVGGLLGAITAQRVPMTSMPEIVALFNGCGGMSSLLVALGVALFPVMGA
EGESRIVEEISIVISVFVGSITFTGSIVAMAKLQGWLSTPPWMQSKARHVVNIALAVVSL
IAAVEMIRNGGSGLWLLVVASALLGIGVTLPIGGADMPVVISLLNSYSGVAAAAAGFVVG
SQLLIVAGAMVGAAGLILTQVMCNGMNRSLVSVLFGGALGASATASGGGGEYTNITSCSA
EECALTLEAAERVIIVPGYGLAVAQAQHTLREVTRSLEAAGIEVAYAIHPVAGRMPGHMN
VLLAEADVPYEQLKEMDVINPEFPATDVVLVLGANDVVNPQAKTDPNSPLYGMPVLDVQQ
ARTVFVVKRGMSAGYSGIKNDLFELGNTSMVFGDAKKVLGDLLGELKELGVGKK
Download sequence
Identical sequences Q0IBP2
WP_011618853.1.57161 64471.sync_0917 gi|113954886|ref|YP_730130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]