SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954893|ref|YP_730904.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954893|ref|YP_730904.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily PurS-like 1.44e-24
Family PurS subunit of FGAM synthetase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954893|ref|YP_730904.1|
Sequence length 84
Comment phosphoribosylformylglycinamidine synthase, PurS protein [Synechococcus sp. CC9311]
Sequence
MPRYQARVLVHLRPSVLDPAGEATRSAASRLGVQGIERLRIGKAVELELEASDEADARQQ
VELLSDRLLANPVIENWTLELKLS
Download sequence
Identical sequences A0A0H4BF24 Q0I9G8
gi|113954893|ref|YP_730904.1| 64471.sync_1700 WP_011619618.1.28265 WP_011619618.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]