SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954954|ref|YP_730623.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954954|ref|YP_730623.1|
Domain Number 1 Region: 183-427
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.19e-70
Family Extended AAA-ATPase domain 0.0000000412
Further Details:      
 
Domain Number 2 Region: 438-635
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.11e-64
Family FtsH protease domain-like 0.00000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954954|ref|YP_730623.1|
Sequence length 643
Comment metalloprotease ATP-dependent, FtsH family protein [Synechococcus sp. CC9311]
Sequence
MNQRWRQIALWILPIGVALLLIWQLVGSGALNNLRSSNAPPSAGTTVAPRNAAVARMSYG
RFLDYVAAGRVTAVDIYDGGRNAVVEAVDPDLDNRVQRLRVDLPGLAPELINTLKDEGIS
FDIHPPKTAPPALGILGNLLFPLLLIGSLIFLARRSNSMPGGPGQAMQFGKTKARFAVEA
DTGVKFDDVAGVSEAKQDLEEVVTFLKQPERFTSVGAQIPKGVLLVGPPGTGKTLLAKAI
AGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIFIDEIDAVGRQRGAGIG
GGNDEREQTLNQLLTEMDGFEGNSGIIILAATNRPDVLDSALMRPGRFDRQVTVDAPDIK
GRLSILEVHSRNKKLDEQLTLDSIARRTPGFTGADLANLLNEAAILTARRRKESIGISEI
DDAVDRIIAGMEGHPLTDGRSKRLIAYHEVGHALVGTLVKDHDPVQKVTLIPRGQAQGLT
WFSPDEEQMLVSRAQLKARIMGALGGRAAEDVVFGHSEVTTGAGGDIQMVASMARQMVTQ
FGMSQLGPMALEGGSQEVFLGRDLMTRSDVSDAISKQIDEQVRLIVMKCYEETVALVGQH
RQAMDKLVEQLIEQETMDGDEFRVVVAEFAEIPEKERFSPLLA
Download sequence
Identical sequences Q0IA99
64471.sync_1417 gi|113954954|ref|YP_730623.1| WP_011619340.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]