SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113954979|ref|YP_731557.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954979|ref|YP_731557.1|
Domain Number 1 Region: 5-260
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.7e-80
Family TatD Mg-dependent DNase-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954979|ref|YP_731557.1|
Sequence length 261
Comment hydrolase, TatD family protein [Synechococcus sp. CC9311]
Sequence
MSTPTLIDSHCHIVFRTFEDDLDAVALRWREAGVTALLHACVEPSEIPAIRSLADRFPEM
RYSVGVHPLDTEHWAADTVEVLSAAAKDDSRVVAIGELGLDLFRDKNLDQQLSVLKPQLD
LAVELDLPVIVHCRDAAEPMLAELRERQLRGNCPRGVMHCWGGTPSEMAAFLDFGFYISF
SGTVTFPKAVDTHICAKDVPQDRFLVETDCPFLAPVPRRGKRNEPAFVASVAERVAELRG
QTVLEVADASTANARRLFALP
Download sequence
Identical sequences Q0I7L5
WP_011620267.1.57161 gi|113954979|ref|YP_731557.1| 64471.sync_2360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]