SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113955003|ref|YP_731354.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955003|ref|YP_731354.1|
Domain Number 1 Region: 10-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.08e-63
Family Nucleotide and nucleoside kinases 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113955003|ref|YP_731354.1|
Sequence length 190
Comment guanylate kinase [Synechococcus sp. CC9311]
Sequence
MAPDGSIARPTVLTGPSGVGKGTLVARLRERHPEIWLSVSATTRAPRSGEIDGIHYFFHS
KERFNKLVQSGGLLEWAEFAGNCYGTPREPVSERVANGIPVLLEIELEGARQVRKSLPEA
IQIFLAPPSVEELEKRIRGRGTEAEEAIQRRLKRAQEELEAQTEFDAVIVNDDLETALAE
LEKQMNLTIS
Download sequence
Identical sequences Q0I868
64471.sync_2153 WP_011620066.1.57161 gi|113955003|ref|YP_731354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]