SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955057|ref|YP_731414.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955057|ref|YP_731414.1|
Domain Number 1 Region: 5-241
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.48e-73
Family SAICAR synthase 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955057|ref|YP_731414.1|
Sequence length 250
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Synechococcus sp. CC9311]
Sequence
MTSTRGSLLYEGKAKRIYASNKEAEVLVEFKNDATAFNAQKRAQLEDKGRLNCQISACLF
ELLEREGIPTHYCGLESDHWMVVQRVKVIPIEVVLRNVATGSLCRQTPIAQGTLLDPALL
DLYYKDDDLGDPLLTESRLFLLDLVSPESRQEIETLARQVNAVLTPFFSALNLQLVDFKL
ELGWNEAGELLVADEISPDTCRLWDMNLRDEKERILDKDRFRQDLGGVIEAYGEVCKRVQ
GATPKPRNYR
Download sequence
Identical sequences Q0I808
64471.sync_2216 WP_011620126.1.57161 gi|113955057|ref|YP_731414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]