SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955074|ref|YP_732040.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955074|ref|YP_732040.1|
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily Folate-binding domain 4.49e-91
Family Aminomethyltransferase folate-binding domain 0.00000141
Further Details:      
 
Domain Number 2 Region: 280-368
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.31e-26
Family Aminomethyltransferase beta-barrel domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955074|ref|YP_732040.1|
Sequence length 369
Comment glycine cleavage system aminomethyltransferase T [Synechococcus sp. CC9311]
Sequence
MDQNCTPLHDLCIAAGGRMVSFAGWEMPVQFSGLMAEHKAVRSDSGMFDISHMGVLRIEG
ANPKDALQQLVPSDLHRIGPGQACYSVLLNEQGGIIDDLIIYDLGPSLLDESHETLLVVI
NAACAETDTAWIRQHLERADLQVLDEKKDGVLLALQGPKAIGLLERLSGSDLSELPRFGH
CSLNIHGLQAPVFTARTGYTGEDGVELLLKADDGRQLWQLLLEEGVTPCGLGARDTLRLE
AAMHLYGQDMDAATTPFEAGLGWLVHLEMPALFIGRQALEQAAEQGPSKRLVGLKLQGRS
IARHDYPVIHNGATVGVVTSGSWSPTLQEPIALASLPPALAKLGTELSVEIRGQLQPATV
VKRPFYRRS
Download sequence
Identical sequences Q0I682
WP_011620740.1.57161 gi|113955074|ref|YP_732040.1| 64471.sync_2853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]