SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955117|ref|YP_729559.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955117|ref|YP_729559.1|
Domain Number 1 Region: 9-182
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.67e-40
Family Phosphoglucomutase, first 3 domains 0.00051
Further Details:      
 
Domain Number 2 Region: 260-367
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.92e-25
Family Phosphoglucomutase, first 3 domains 0.0044
Further Details:      
 
Domain Number 3 Region: 159-259
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-22
Family Phosphoglucomutase, first 3 domains 0.0029
Further Details:      
 
Domain Number 4 Region: 361-451
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.44e-20
Family Phosphoglucomutase, C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113955117|ref|YP_729559.1|
Sequence length 455
Comment phosphoglucosamine mutase [Synechococcus sp. CC9311]
Sequence
MGQLPKPSKISFGTDGLRGRVDTMLTPALALQVGYWCGRVLQAEGPVLIGMDSRSSGSML
VAALTAGLTASGREVWTLGLCPTPAVPGLIRRYSAAGGLMVSASHNPPEDNGIKVFGATG
SKLSPERQQAIEAGLCGGDGSGMALAASGAARHRPELLDDYRASLLSSVGQHRLDGVPIV
LDLCWGSATACGAEVFSALGADLTVLHGDPDGTRINVNCGSTHLEALRRAVIEKGAAMGF
GFDGDADRMLAVDGQGRVVDGDHVLFLWGSVLQEQGQLPDQRLVATVMSNLGFERAWQAR
GGLLDRTPVGDQHVHAEMVRTGAALGGEQSGHILSSAHGLAGDGVLTALQIASLCHAQQL
SLAEWVDQSFQAYPQKLVNVRVENRERRKGWADCAPLSSLVQEAEASMAEDGRVLVRASG
TEPLLRVMVEAADQAVVDHWTSSLAAAAELHLNAS
Download sequence
Identical sequences Q0IDB3
64471.sync_0325 gi|113955117|ref|YP_729559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]