SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113955131|ref|YP_730483.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955131|ref|YP_730483.1|
Domain Number 1 Region: 6-226
Classification Level Classification E-value
Superfamily Ribosomal protein S2 2.35e-89
Family Ribosomal protein S2 0.000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955131|ref|YP_730483.1|
Sequence length 238
Comment 30S ribosomal protein S2 [Synechococcus sp. CC9311]
Sequence
MAVVTLAEMMEAGAHFGHQTRRWNPKMSRYIYCARNGVHIIDLVQTAVCMNNAYKWVRSA
ARSGKRFLFVGTKKQASEVVAQEALRCGSSYVNQRWLGGMLTNWTTMKARIDRLKDLERM
ESSGAIAMRPKKEGAVLRRELERLQKYLGGLKNMRRIPDVVVLVDQRRETNAVLEARKLD
ISLVSMLDTNCDPDLCEVPIPCNDDAVRSIQLVLSRLADAINEGRHGGQDGRGDDGQG
Download sequence
Identical sequences A0A1Z8WAL9 A0A2D7U4X1 A0A2E9J266 A0A2H4P439 A0A2H4P484 G4FJY0 Q0IAN9
gi|113955131|ref|YP_730483.1| 64471.sync_1275 WP_006852470.1.44266 WP_006852470.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]