SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955176|ref|YP_730890.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955176|ref|YP_730890.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 5.36e-45
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00063
Further Details:      
 
Domain Number 2 Region: 327-430
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 2.62e-25
Family Glutamyl tRNA-reductase dimerization domain 0.0085
Further Details:      
 
Domain Number 3 Region: 160-324
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.17e-25
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113955176|ref|YP_730890.1|
Sequence length 437
Comment glutamyl-tRNA reductase [Synechococcus sp. CC9311]
Sequence
MHIAVVGLSHRTAPVEVREKLSIPEQTMEESLQNLRNHEQVLEASILSTCNRLEIYTLVR
NPDLGIAAVRDFLSGHSGLESRDLSPHLFTYHHDEAIAHLMRVTAGLDSLVLGEGQILSQ
VKKMMRLGQEHKSIGPILNRLLTQAVSTGKRVRSETNLSTGAVSVSSAAVELAQLKLGQS
RGQDALVTLETEQIAVVGAGRMSRLLLQHLQAKGASGVVLLNRTIERASALATDFPNLPI
QCRGLDDLDQCLSTCSLVFTSTAVDDPIIDANRLNALNRRSSLRLIDIGVPRNIASDVHE
VSGVESHDVDDLQEVVERNQEARQQVAREAEGLLLEEGRLFLEWWDSLEAVPTINRLRAS
LEEIRVEELTKALSRMGPDFSARERKVVEALTKGMINKILHTPVTQLRSPQQRSERQQAL
QVVEKIFDLESGAATQD
Download sequence
Identical sequences Q0I9I2
64471.sync_1686 WP_011619604.1.57161 gi|113955176|ref|YP_730890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]