SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955197|ref|YP_731924.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955197|ref|YP_731924.1|
Domain Number 1 Region: 17-408
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 4.45e-131
Family ArgJ-like 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955197|ref|YP_731924.1|
Sequence length 411
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Synechococcus sp. CC9311]
Sequence
MTQSVIWSPISGGITTPTGFKAAGLSAGLKPSRKPDLSLLLAPEGALCAGTFTTSVVRAA
CVDLCADRLQVASGRVRAVVTNSGQANACTGDRGLVDSLRITQAVADRLGCSQDEVLICS
TGVIGVPIAMDPLLAAVDSLVSALSPEGGAAAAQAILTTDLVEKQVAFEADLGGRRVRIG
GMAKGSGMIHPNMATMLGYLTCDAAVPCDLWQEIVRRAVDRSFNSITVDGDTSTNDTFLA
FAAGDLLPANQFAELEEGVTLVAQYLARSIARDGEGATCLIEVQVEGTDSEAEARKIART
ICGSSLVKTAVHGRDPNWGRIVAAAGRAGVPFSADAVALWIGPHQLMSAGQPLLFDRAAA
SAYLSERACSRYLVDDTVQIRLSLGDGAGQGIAWGCDLSDQYVRINADYTT
Download sequence
Identical sequences Q0I6J8
WP_011620628.1.57161 gi|113955197|ref|YP_731924.1| 64471.sync_2736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]