SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955273|ref|YP_730522.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955273|ref|YP_730522.1|
Domain Number 1 Region: 29-460
Classification Level Classification E-value
Superfamily Clc chloride channel 1.05e-56
Family Clc chloride channel 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113955273|ref|YP_730522.1|
Sequence length 462
Comment chloride channel [Synechococcus sp. CC9311]
Sequence
MHWPRPPAMTSELKSTSSRFRGTASVFNEITRLGRHFIGLLVVGVLIGLACLPLNLVDRI
QEWQFQFLPTTGENPWTSIGLLIVFAPLLVMPILLILQRGPWRGGAGSGIPSTMNALGDP
SLMPSAMEAGSTVHRGILWSVATAAMFPLGREGPVVQFGSAVARACQKRWPNWMPALTER
QMVAIGGGAGLAGGFNTPLLGVVFMLEELTAEYSILTIWPALLVCIAAAGFSNLGGEPIF
GLGLINVFAPESEQLLLAVPIGIAAGLVGGFFNRGLVWTTSRLAPMVRQRPLRTGLWLGA
ALSVLALLSWGTSTADGEALVKQLLERGLPELGADHSDVHSGLVSIWITVVRVIGPMLAL
APGVPGGLIDPALTFGAVLGYSICAVIGFSTQVGVGLGLAAGLAGATQLPLVSLIFSWRL
VGDQQLFAGACLTAVIAAYTGRLVSRTPVYHALAKLQRAPRL
Download sequence
Identical sequences Q0IAK0
gi|113955273|ref|YP_730522.1| 64471.sync_1314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]