SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955324|ref|YP_729250.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955324|ref|YP_729250.1|
Domain Number 1 Region: 347-548
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-44
Family Nitrogenase iron protein-like 0.00000171
Further Details:      
 
Domain Number 2 Region: 244-321
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 6.02e-16
Family Domain of the SRP/SRP receptor G-proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113955324|ref|YP_729250.1|
Sequence length 551
Comment signal recognition particle-docking protein FtsY [Synechococcus sp. CC9311]
Sequence
MVYDWFNRGSVPPETPADPLVDPEVQSDQSSAPQPSATEPSGTQPADVQASEPQSTESED
DSLEWARQAYARLKAQKAQAAEAAKTVQDDSTSVQNVVVPPVMEPPAVVPETVVPSVVSP
SEEPPALEAPSVEPAQPAPVVEPAVVPAPTPAASASPATTPTPPAPALSFLEQAAAQRDQ
RQQELEQPAEPNPVPVVPADAQDAPNIDEDEPSLGDFDDAFTWSAEVLAAQGRSAEQVTL
EEIDWLGRLRQGLEKTRQGFVTGLLENLGDDPLTPEVLDDLESLLLRADAGVQATDQVLD
ALRQRMNEQVVDPSEGIRFLKEQLRDLLDEPIKSSAVEVLAPQRDRLNVWLLVGVNGVGK
TTTLGKLANLAVRSGYSALIAAADTFRAAAVQQVQVWGDRSDVPVVANPSANADPAAVVF
DAIGAARSKGTDLVLVDTAGRLQTKHNLMEELEKIRRVVDRLAPEAHVESLLVLDASQGQ
NGLKQAMAFARAAGLTGVVITKLDGTARGGVALAVASEAKLPIRFIGAGEGIRDLRPFNS
FEFVEALLASR
Download sequence
Identical sequences Q0IE72
WP_011618002.1.57161 64471.sync_0011 gi|113955324|ref|YP_729250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]