SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955332|ref|YP_730509.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955332|ref|YP_730509.1|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Formyltransferase 1.03e-55
Family Formyltransferase 0.00000413
Further Details:      
 
Domain Number 2 Region: 217-325
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.16e-17
Family Post formyltransferase domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113955332|ref|YP_730509.1|
Sequence length 342
Comment methionyl-tRNA formyltransferase [Synechococcus sp. CC9311]
Sequence
MNILFWGTPDYAVPTLMALHQAGHTIVGVVTQPDRRRGRGKTLVPSAVKAKAIKMGLRVF
TPERIKQDETCQQQLAELQPDLSVVVAFGQILPKNVLNQPPLGCWNGHGSLLPRWRGAGP
IQWSILEGDPETGVGVMAMEEGLDTGPVLIERNLPIGLLDNGHTLAERMSVLTAELMVEA
MPLIESAGQGSEPERRARLKVMNQSDRSGDASYARMLTKQDHQIDWSASALNIHRKVMAL
YPNAVTLWNDKRLKLLHCEPLIDRLREELPAEVHPLIGRWPTGGHPPGTVLESVKGLGVV
VSTSGCPILVRAAQLEGKGRSDGDSLIQQLNAAAEQQFGTFS
Download sequence
Identical sequences Q0IAL3
gi|113955332|ref|YP_730509.1| WP_011619229.1.57161 64471.sync_1301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]