SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955394|ref|YP_730733.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955394|ref|YP_730733.1|
Domain Number 1 Region: 94-236
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 3.27e-29
Family L,D-transpeptidase catalytic domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955394|ref|YP_730733.1|
Sequence length 238
Comment protein erfK/srfK precursor [Synechococcus sp. CC9311]
Sequence
MRCPKHAPSMGLRTSLLAASLLCLVGGAGVGGAGIATAQEVAEERQGEIKGEILVEAPEE
APKRKSDPIPPLAIPLSDTASLARIPDDLMERKGLQLVLDRKHHQLLVLKDGQMTRRFPA
AVGTTGWETPAGRFRVFEKVKDPVWTHPVSGDLVDAESKGNPLGSRWIGFYRDCNGRSGW
DGEQYLDINGCTVAGFHGTPYRWTVGRAVSHGCVRLYEENVQEVFDLVRVGTQVTVLP
Download sequence
Identical sequences Q0I9Y9
64471.sync_1528 gi|113955394|ref|YP_730733.1| WP_011619450.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]