SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955418|ref|YP_730141.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955418|ref|YP_730141.1|
Domain Number 1 Region: 572-994
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-135
Family DNA polymerase I 0.0000000117
Further Details:      
 
Domain Number 2 Region: 373-565
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.49e-40
Family DnaQ-like 3'-5' exonuclease 0.0000976
Further Details:      
 
Domain Number 3 Region: 8-167
Classification Level Classification E-value
Superfamily PIN domain-like 1.01e-38
Family 5' to 3' exonuclease catalytic domain 0.0000833
Further Details:      
 
Domain Number 4 Region: 188-313
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 3.44e-26
Family 5' to 3' exonuclease, C-terminal subdomain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113955418|ref|YP_730141.1|
Sequence length 994
Comment DNA polymerase I [Synechococcus sp. CC9311]
Sequence
MSSTSDQPLLLLVDGHSLAFRSFYAFSKGGEGGLATKEGIPTSVTYGFLKALLDNCKGLK
PNSVTIAFDTAEPTFRHKADPNYKAHRDVAPAHFFQDLEQLQAILTTQLKLPLCLAPGFE
ADDVLGTLANRAAADGWSVRILSGDRDLFQLVDDSRNIAVLYMGGGPYAKSSGPTLIDEA
GVQAKLGVAPTKVVDLKALTGDSSDNIPGVKGVGPKTAISLLKDNDDLDGVYRALAEVEE
EGPKASRGAIKGALKAKLANDKDNAYLSRHLAEILVDIPLPKEPKLDLGSVDGDGLSQRL
KELELNSLIRQVPNFVATFSSGGLAANAHLLAKAEEEQRTVKDEAATSAQPSGPEAISEA
SSSQTQPVLRPGIVQTLDQLKALLTQLMNCRDPLAPVALDTETTDLNPFRAQLVGIGMCW
GPGSDDLAYIPVSHQGDPIPDQLPLETVLQALAPWLASGEHPKALQNAKYDRLILLRHGL
PLAGVVMDTLLADYLRDAAAKHGLDAMAQRDYGISPTLFSDLVGKAKEGKASNFSEVPLE
SAAQYCGMDVHLTRKLAIDLNQQLEALGPQLPNLLSKVELPLEPVLAVMEATGIRIDVPY
LEALSCEIGTNLERLEASAKEAAEIDFNLASPKQLGDLLFNTLGLDRKKSRRTKTGYSTD
ATVLEKLEHDHPVVPLVLEHRVLSKLKSTYVDALPQLVEAETGRVHTDFNQAVTATGRLS
SSNPNLQNIPVRTEYSRRIRKAFLPQDGWTLLSADYSQIELRILTHLSGEEVLQQAYRDG
DDVHALTARLLLDKDEVSPDERRLGKTINFGVIYGMGAQRFARETGVSQSEAKDFLSKYK
QRYPKVFAFLELQERLALSQGYVETILGRRRPFHFDRNGLGRLNGMDPLEINLEVARRGG
MEAQQLRAAANAPIQGSSADIIKLAMVQLQAKLESKNLPARLLLQVHDELVLETEPEALA
VVEELVVQTMKNAIDLSVPLEVETGNGANWMECK
Download sequence
Identical sequences Q0IBN1
WP_011618864.1.57161 gi|113955418|ref|YP_730141.1| 64471.sync_0928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]