SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955431|ref|YP_729775.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955431|ref|YP_729775.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 3.05e-40
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113955431|ref|YP_729775.1|
Sequence length 160
Comment cytochrome b6-f complex subunit IV [Synechococcus sp. CC9311]
Sequence
MHILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACIVGLSVLDPA
MLGDKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLIPFIESFNKF
QNPFRRPIAMAVFLFGTATTIYLGIGAAMPIDKSLTLGLF
Download sequence
Identical sequences A0A0H4BFH9 A0A2E9J3Y0 G4FQ46 Q0ICP7
64471.sync_0550 WP_006854933.1.28265 WP_006854933.1.44266 WP_006854933.1.57161 gi|113955431|ref|YP_729775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]