SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955458|ref|YP_729741.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955458|ref|YP_729741.1|
Domain Number 1 Region: 21-187
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.55e-32
Family Pentapeptide repeats 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955458|ref|YP_729741.1|
Sequence length 229
Comment pentapeptide repeat-containing protein [Synechococcus sp. CC9311]
Sequence
MNFDINNWRPPELASPENITHYPVDARGADWQNKDIGNLDLREANLCRADLRGANLSGCQ
IENVDMRLAKYDNKTQLPEGFNIRTSGAIGPGAQLNGAFLNNADLRGIDLRKGSLMGAYL
SGADLSGALLDNISMAGADLRNAILRGAMCRRTRFGTSELNMADLRGADLTEASLETVES
IKGSDFSMCKGMKPNIQLLLERPAIELDHWNPLTRSSARSSLESLLLEA
Download sequence
Identical sequences Q0ICT1
64471.sync_0514 WP_011618473.1.57161 gi|113955458|ref|YP_729741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]