SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113955489|ref|YP_731487.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113955489|ref|YP_731487.1|
Domain Number 1 Region: 181-434
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 6.8e-80
Family Creatinase/aminopeptidase 0.000000602
Further Details:      
 
Domain Number 2 Region: 8-180
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 5.18e-49
Family Creatinase/prolidase N-terminal domain 0.0000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113955489|ref|YP_731487.1|
Sequence length 445
Comment peptidase, M24B family protein [Synechococcus sp. CC9311]
Sequence
MVHSSLPIDAQGYAERRQRFMAHLGGAAAVIPAATLVTHHADCEWPFRQNSDFWYLTGFD
EPDAVALFLPHRPEGERYVLFVNPREPGAEVWTGRRWGTEGAVDQFGADIAHPRSELATH
LRGYLKDAEGIAFRTGHHPAVEAVVLEVWAEQLDRASRRGAAALGLVAPCPVLHELRLRK
DPAELDRMREACRISAEAHELARAAVQPGMSERQVQALIEFHFLDQGARGPAYGSIVAGG
DNACVLHYIDNQDLLKDGDLLLIDAGCSIGDYYNGDITRTFPVNGRFSGEQRALYELVLS
AQESAIATVRPGGTAEEVHQTALRQLVDGLLDLGLLAGEADGIIEQGAYRHLYMHRTGHW
LGLDVHDVGAYRLGEHHVELDPGMVLTVEPGLYVSDRLPVPDGQPEIDECWKGIGIRIED
DVAVLKDGYEVLTATALKSVASMER
Download sequence
Identical sequences Q0I7T5
gi|113955489|ref|YP_731487.1| WP_011620199.1.57161 64471.sync_2290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]