SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|228916066|ref|YP_730488.2| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|228916066|ref|YP_730488.2|
Domain Number 1 Region: 144-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.2e-43
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000322
Further Details:      
 
Domain Number 2 Region: 445-581
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.28e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00013
Further Details:      
 
Domain Number 3 Region: 45-143
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.56e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0073
Further Details:      
 
Domain Number 4 Region: 367-437
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.3e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|228916066|ref|YP_730488.2|
Sequence length 585
Comment sulfite reductase subunit beta [Synechococcus sp. CC9311]
Sequence
MLDGPSTPTESIDTALSKAEKRKLYSGHLREPLLTELSNEEIRFSEDAVQLLKFHGSYQQ
NHRELRKIDKIKCWQMMLRLRNPGGRVPAQLFSALDDLSNQYGNGTLRITTRQAFQMHGI
PKADLKTVIGTIIKNLGSTLAACGDINRNVMAPAAPFENNGYPAARKLADEIADLLSPKA
AEGSYLDMWVNGDLSYRFKPAKPVKQARKRQFEEGVFSGSQDEPIYGDTYLPRKFKVAVT
VPGDNSVDLLTQDIGLVLFTNKNGTMRGCNVYVGGGLGRTHNQEDTFARIADPLGYVDAE
NIFDLLQSIMALQRDHGDREVRKHARMKYLLHNRGIQWFRETLINHYFKRDIKSLIKESP
AKLMDYLGWHRQKPGLWFVGLPFMCGRLEGSVKAGIRTIVERYQLEIRLTPNQDLLLCNI
GSNQKSSIKSELTELGFELPAEVAPLVRHALACPALPTCGLAVTESERVLPDVLERLDSQ
LNHLEIKKSILVRMTGCPNGCARPYMAELGLVGSGVNQYQLWLGGSANLQRLARPFLQKM
PLEDLETTIEPLLLSWKDAGGRRGFGEHISKLGDATVQEMLKVPS
Download sequence
Identical sequences gi|228916066|ref|YP_730488.2| WP_011619208.1.57161 64471.sync_1280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]