SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952938|ref|YP_730795.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952938|ref|YP_730795.1|
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.02e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000785
Further Details:      
 
Domain Number 2 Region: 187-322
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.83e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113952938|ref|YP_730795.1|
Sequence length 327
Comment pyruvate dehydrogenase E1 subunit beta [Synechococcus sp. CC9311]
Sequence
MAGTLLFNALREAIDEEMARDPHVCVMGEDVGQYGGSYKVTKDLYEKYGELRVLDTPIAE
NSFTGMAVGAAMTGLRPIVEGMNMGFLLLAFNQISNNMGMLRYTSGGNFTIPTVVRGPGG
VGRQLGAEHSQRLEAYFHAVPGIKIVACSTPTNAKGLMKAAIRDNNPVLFFEHVLLYNLT
EELPDGDYTCALDQADLVKEGSDVTILTYSRMRHHCLKAVEQLEADGINAELIDLISLKP
FDMETIARSIRKTHRVIVVEECMKTGGIGAELIALITEHCFDDLDARPIRLSSQDIPTPY
NGNLENLTIIQPHQIVETAQAIVRKGL
Download sequence
Identical sequences Q0I9S7
WP_011619512.1.57161 64471.sync_1590 gi|113952938|ref|YP_730795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]