SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954373|ref|YP_730007.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954373|ref|YP_730007.1|
Domain Number 1 Region: 169-305
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.98e-38
Family ATP-dependent riboflavin kinase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 14-173
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.39e-25
Family Adenylyltransferase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954373|ref|YP_730007.1|
Sequence length 309
Comment riboflavin biosynthesis protein RibF [Synechococcus sp. CC9311]
Sequence
MIHLCSPQQAKTPTTLALGSFDGLHAGHRRVISSVTETDHLHAIPTVVSFWPHPREVLHG
EPRLRLDLPEEKLELLEPLSIQQLVLVPFNRQLAQLSAADFVEQVLLGCLKARQIAVGAN
FRFGRGRKGDTNTLRALAEAAGVQVSVLPILEDAEGRMSSSRIREALSNGDLQTASALLG
RPYRFRGTVVRGRGLGRDLGWPTANLQVDGRKFLPGLGVYAARAWTQRDGEALPAVMNLG
PQPTVDPNSPSAVEVHLLDRRIELVGQELVVEPVERLRGQQRFSGLDELSAQIGQDADAA
RQRLQAAAG
Download sequence
Identical sequences Q0IC15
WP_011618734.1.57161 64471.sync_0793 gi|113954373|ref|YP_730007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]