SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954823|ref|YP_731228.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113954823|ref|YP_731228.1|
Domain Number - Region: 7-82
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 0.00111
Family YjeF N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954823|ref|YP_731228.1|
Sequence length 264
Comment precorrin-6x reductase [Synechococcus sp. CC9311]
Sequence
MHRQENRQGTVWLLAGTGDGPHLAEVLISQGWHVHVSVVGDMAAHPYRGMALEAIHVGAL
DGSWGISQWLQTIPVDWVVDATHPFALRISDQLNQACKRSGHRLVRFERRMEASGQAVVL
GSIADLADQPLSGRQLLLALGARQLVEAAMVARKAGATVFARVLPSPLSLIQAAAAGIPS
EHLAVVRPLQGPEPGALEAAVCRRWAITDVVCRQSGGATEALWARLSMQMGFGLWLLRRP
APIAEVPVVNSVSQLLAHLNGKTP
Download sequence
Identical sequences Q0I8J4
gi|113954823|ref|YP_731228.1| WP_011619940.1.57161 64471.sync_2025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]