SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148378221|ref|YP_001252762.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148378221|ref|YP_001252762.1|
Domain Number 1 Region: 3-278
Classification Level Classification E-value
Superfamily DAK1/DegV-like 8.89e-87
Family DegV-like 0.00000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148378221|ref|YP_001252762.1|
Sequence length 279
Comment DegV family protein [Clostridium botulinum A str. ATCC 3502]
Sequence
MEKIKIITDSTADLPKDIIEKYDIEVIPLFVSFGDKVYKDGVDIKLEQLFTKIEKENVFP
QTSQVNPQRFYEHYKKYIDKGYSIISIHISSKMSGTYQSACLAKDMLDSDNITVIDSNNV
TSGLGLLVIKACKLKDEGLSMEEIVKGVKETIPHIKSVLAFETLDYLVKGGRLSKTAGFI
GNVLGIKPILAVENGEMVVKDKVRGSKKAIRAIFEYIGKLGLKQGEPCILLHVQNKDILG
TLRENLNQDEANFIECTVGCVVGIYAGPRACGIFFIEDY
Download sequence
Identical sequences A5HYB1
WP_011948024.1.21778 WP_011948024.1.57120 YP_001252762.1.75347 gi|148378221|ref|YP_001252762.1| 413999.CBO0218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]