SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148379290|ref|YP_001253831.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148379290|ref|YP_001253831.1|
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.17e-84
Family DegV-like 0.00000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148379290|ref|YP_001253831.1|
Sequence length 297
Comment DegV family protein [Clostridium botulinum A str. ATCC 3502]
Sequence
MKEYIIMTDSCCDLPSEYIENNHIPYIPLTCNVEGKEYIDNFGQSLPYKQFYEAMIKGEI
PKTSQPSPEAYYKVFKELIDKDKDILYVCVSSGLSGTYNSANIAKNMILDEFRNARIEIV
DVLTASLGQGIMVMKAMDMKKNGLTIDEVTSYLEENKLNLNSYMVVNDLIHLKRGGRIST
AAALIGTVLNIKPILTLNDEGRVITVRKAKGRKVAIRKLAEIVIERIKNPEEEIVAISHG
DSDLDAEKLRERILKEIKVKDIIINYVGPVVGTYGGPGSLNVFFMSDHRQNHIIDIN
Download sequence
Identical sequences A0A0E1QK35 A0A175M2D6 A5I1E6
gi|153937557|ref|YP_001387214.1| gi|153933255|ref|YP_001383665.1| 413999.CBO1311 441770.CLB_1338 441771.CLC_1348 gi|148379290|ref|YP_001253831.1| WP_011948925.1.10598 WP_011948925.1.11430 WP_011948925.1.21778 WP_011948925.1.25111 WP_011948925.1.27088 WP_011948925.1.28409 WP_011948925.1.34822 WP_011948925.1.46754 WP_011948925.1.49536 WP_011948925.1.49637 WP_011948925.1.5655 WP_011948925.1.57120 WP_011948925.1.63111 WP_011948925.1.63218 WP_011948925.1.65258 WP_011948925.1.73124 WP_011948925.1.74799 WP_011948925.1.75721 WP_011948925.1.92266 YP_001253831.1.75347 YP_001387214.1.17653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]