SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148380126|ref|YP_001254667.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148380126|ref|YP_001254667.1|
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily AF1862-like 3.01e-17
Family Cas Cmr5-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148380126|ref|YP_001254667.1|
Sequence length 144
Comment hypothetical protein CBO2172 [Clostridium botulinum A str. ATCC 3502]
Sequence
MNKREIEKQIPIAIDLIDEFMKKKKFLKKDDKEDDKKLKGIAKEYKGYISNFGASIIQSG
LLSTVAFFEANDSKSKSDKQVLMDLILKVVDIYNEKQLEWKNNSPFLHYILENNNKQTEE
EVINAAIAVKLAMRVFKFTENSES
Download sequence
Identical sequences A5I3U3
gi|148380126|ref|YP_001254667.1| WP_011986671.1.63111 YP_001254667.1.75347 YP_001387960.1.17653 gi|153934319|ref|YP_001384424.1| 413999.CBO2172 441770.CLB_2110 441771.CLC_2114 gi|153935378|ref|YP_001387960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]