SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148381127|ref|YP_001255668.1| from Clostridium botulinum A str. ATCC 3502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148381127|ref|YP_001255668.1|
Domain Number 1 Region: 40-150
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 3.27e-31
Family L,D-transpeptidase catalytic domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 160-226
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000179
Family Peptidoglycan binding domain, PGBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148381127|ref|YP_001255668.1|
Sequence length 231
Comment ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A str. ATCC 3502]
Sequence
MSNFKKLFYTLIFILIVEIILIFLSHHNQQKMKTNPIDNSNICILIDITANNMDVYRNGE
IIKSYSIATGKSSTPSPIGTWKITNKGTWGSSFGGRWMGLNVPWGKYGIHGTNAPNSIGW
SSSHGCIRMKNKNVAELYKITSLGTPVIIWGGPFGNFGQGLRPIEPGMRGSDVYEVQKLL
KEKKYYNGDPDGIYGESMKSVVHKFQEDNNIPLSNTINSSFYKKLGVELIE
Download sequence
Identical sequences A0A0M1L782 A5I6Q8
gi|148381127|ref|YP_001255668.1| gi|153934739|ref|YP_001388908.1| gi|153930963|ref|YP_001385502.1| 413999.CBO3179 441770.CLB_3215 441771.CLC_3089 WP_012048168.1.10598 WP_012048168.1.25111 WP_012048168.1.27088 WP_012048168.1.28409 WP_012048168.1.34822 WP_012048168.1.46754 WP_012048168.1.63111 WP_012048168.1.63218 WP_012048168.1.65258 WP_012048168.1.73124 WP_012048168.1.75721 WP_012048168.1.92266 YP_001255668.1.75347 YP_001388908.1.17653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]