SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119714290|ref|YP_921255.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119714290|ref|YP_921255.1|
Domain Number 1 Region: 77-276
Classification Level Classification E-value
Superfamily Rhomboid-like 1.44e-39
Family Rhomboid-like 0.0011
Further Details:      
 
Domain Number 2 Region: 6-40
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000458
Family B-box zinc-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119714290|ref|YP_921255.1|
Sequence length 306
Comment rhomboid family protein [Nocardioides sp. JS614]
Sequence
MSEHATPPAGVPTCYRHPGREAHIRCQRCDRPICPDCMRDAAVGFQCPECVAEGRKSTRA
GRTAFGGLRPGNAGTTSFVLIGINAFVWLMILASGGSSSRVLAWLELRPNGLCLNAAGGF
DTTRAVCSGRGEWLPGVYDGAYWQLLTSTFTHVQPLHIAFNMFALYVLGPQLELAIGRIR
FLALYLLSGLTGSALVYWASPEFQATVGASGAIFGLMGALLVVAYKMRANTQQILMWIGI
NFVFTVVVSNISWQGHLGGFLGGLVIAAILVYAPRGPKRPWFQVSGLVLVAALTAVAVVL
RTAALG
Download sequence
Identical sequences A1SCN3
196162.Noca_0018 gi|119714290|ref|YP_921255.1| WP_011753519.1.100580 WP_011753519.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]