SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119714582|ref|YP_921547.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119714582|ref|YP_921547.1|
Domain Number 1 Region: 328-500
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 3.01e-46
Family Oxidoreductase molybdopterin-binding domain 0.00043
Further Details:      
 
Domain Number 2 Region: 14-63,102-249
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.57e-23
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119714582|ref|YP_921547.1|
Sequence length 517
Comment oxidoreductase [Nocardioides sp. JS614]
Sequence
MMMHPILQAATSSTELGFPWWLQVTHLVNFLFLGLLVRSGWEILASHPRLYWRNDCGPDT
EWLKFTKDKVPSEIGAFTARDDQRDLHPLISLPGRAKIGIGRAWHGLITTLWVLNGLIYV
VLLFGTGQWRRLIPTSWSVFPEAWDSLKIYAGFGVPSIEHFQPYDALQQLMYTFVVFVLA
PLMIVTGPVMSPAVVGRYPWYPKLFGGRQAARSLHFLGMAFFVVFAVMHVALVLLVHREH
NLVHMMMGEEYDAALVGQAVTRVIVGVVVVVALWIAASYVSLIDVRKSQRVLYGLQAPIK
KLVLNPMTSRQRARQVFTEDDISPFHWVNTRPPDLSQSPEWLALRDGGFRDFRLEVGGLV
REPRSFSLDELREIAAQDQITMHTCMQGWTGIAKWSGIPLREVLAQVEPLEGADYVMIES
FGTAQHMHDGRPVEPYYTVLTKAMAMEDETILAWGMNGAPLPEMYGAPLRLRTESMHGYK
MVKWVRSVSWIHDYKEVGDGMGGTREDSGYQDMDARI
Download sequence
Identical sequences A1SDH5
196162.Noca_0316 gi|119714582|ref|YP_921547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]