SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119715008|ref|YP_921973.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119715008|ref|YP_921973.1|
Domain Number - Region: 90-125
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0122
Family Phase 1 flagellin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119715008|ref|YP_921973.1|
Sequence length 130
Comment flagellar basal-body rod protein [Nocardioides sp. JS614]
Sequence
MGAFDTLTIAGSSMGVHQTWLDTLASNIANVNTVTPTSQNAFQAQMLIVRSAVGGGVEVA
GLAQSDPQGRLVSDPGNPMADADGYVRAPDMDMSTQMTQLVMAQRGFQASVQVTKQAQET
YTAALQIGRA
Download sequence
Identical sequences A1SEQ1
WP_011754235.1.100580 WP_011754235.1.96005 196162.Noca_0761 gi|119715008|ref|YP_921973.1| 2005193231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]