SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119715016|ref|YP_921981.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119715016|ref|YP_921981.1|
Domain Number 1 Region: 140-460
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.27e-23
Family Phase 1 flagellin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119715016|ref|YP_921981.1|
Sequence length 466
Comment flagellar hook-associated protein FlgK [Nocardioides sp. JS614]
Sequence
MAGSFSSINTALTALRYQQVALDVASTNVANVGTDGYVRRRVVGETLGAASSPAVWSRSL
ETGSGVQAARVDRMTDALLDSRVRREHGRQTYLDSRAEALARVETGLAEPGPSGVAAALS
DLRATLNDLGNAPGSDAARSQALSAAASVVDTVRLQAAHLSDEASDQRSHLLASVVEANS
VATELAATNRTIAAALGGGSDTTTLMDERDALALRLAELTGARGTVRADGSMYVELGGQA
LVDGNSAAQLVVTGGVAADGSATGGPVTFDLDPDTTGATTALTGTPGGDLGATINVLDDV
LPSYISGLAAVAKDLADHVNAQHQLGYDANGVAGGKLFDYDPTDVLGTFDVVITDASKLA
VSALPGGVKDGNNATALAAAVDVDDQYQRLVNGFGSTVASARQMAKNQQALTDQVDSARE
QLTGVSLDEETVNMVAAQRAYEAAARVMTTLDSVLDTLINRTGLVR
Download sequence
Identical sequences A1SEQ9
WP_011754243.1.100580 WP_011754243.1.96005 196162.Noca_0769 gi|119715016|ref|YP_921981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]