SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119715017|ref|YP_921982.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119715017|ref|YP_921982.1|
Domain Number 1 Region: 5-305
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.24e-57
Family Phase 1 flagellin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119715017|ref|YP_921982.1|
Sequence length 305
Comment flagellar hook-associated protein 3 [Nocardioides sp. JS614]
Sequence
MGTVRMTQGMMSRQALTGMQAGLNRLANVQEQLSTGRVINRPSDDPTGATSAMRLRSSVS
DQKQYVRNADNGLGWLNQIDSTLSSITDQVRRAHEVALQGANTGSLGAEAREALAIEIDQ
IRSGLVSTANATYLERPVFGGVTAGSAAYAEDPVTGAVTYLPGALTTGEGVVRVVGAGAK
VRVDVEGPDVFGPDGDSVFDHLTALAAALRAGDAAAITASAGILDADTRKVTNVQADIGV
RTKRVEQARTAANDADLRLTSSLSEVENTDMVKATVDLQLQEVAYQAALSATARVMQPSL
LDFLR
Download sequence
Identical sequences A1SER0
WP_011754244.1.100580 WP_011754244.1.96005 196162.Noca_0770 gi|119715017|ref|YP_921982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]