SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119717168|ref|YP_924133.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119717168|ref|YP_924133.1|
Domain Number 1 Region: 10-204
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.66e-44
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00012
Further Details:      
 
Weak hits

Sequence:  gi|119717168|ref|YP_924133.1|
Domain Number - Region: 259-328
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00157
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119717168|ref|YP_924133.1|
Sequence length 342
Comment cytochrome b/b6 domain-containing protein [Nocardioides sp. JS614]
Sequence
MDDRMGIKALDYPVPAHANTLAWSLGGLTAVSLGVLIITGVLLVQFYIPDPTQANQSVRS
LTTEVPGGAFVRGIHFWAAQSMYVLAGLHLIRVFLTSSYKKPREGNWLVGVAMFALTFVA
IFTGTVLKWDQEGFEALGHNVESAKELGAAGWWFTPTFAPDTPILTRVYGAHVVLIPGLI
LLLLFVHVLLIKRHRISPHPLLPDEGTGQAPAREATEPFTRHLRRISAFGLVLIGILALL
TLVRPPGVGTPPVEGVEFTRPMWPFWPMFTLENWLGVSGILWGGAGLFGVLALVPFVDRN
PARHPRHRKVALTLGALFLLGYVVLTVLMLVLPAKEHLEMGM
Download sequence
Identical sequences A1SKW1
gi|119717168|ref|YP_924133.1| 196162.Noca_2944 WP_011756383.1.100580 WP_011756383.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]