SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119717510|ref|YP_924475.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119717510|ref|YP_924475.1|
Domain Number 1 Region: 9-211
Classification Level Classification E-value
Superfamily DhaL-like 6.54e-36
Family DhaL-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119717510|ref|YP_924475.1|
Sequence length 552
Comment Dak phosphatase [Nocardioides sp. JS614]
Sequence
METPRSGAITLEVVLRFVDIATDALADAREEIDALNVYPVPDGDTGTNMYLTVSAARDAV
REATGGDPASDLGTALAAFSRGALLGARGNSGVILSEMLGAIARRIGSAEPGERNALVMA
DALHRATEASYAAVGIPVEGTMLTVTRAASEAATEIARDPGCRARDVFTAAAAAAREALA
HTPEQLPVLREAGVVDAGGRGVSVILDAAETVLTGRRPVPVTAPFGSHHIPIPTAAKTGD
LTPDGPSYEVMYLLDADDAAIPGLRTALGGLGDSLVVVGGEGLWNVHVHVDDVGAAIEAG
IAAGRPHRVRVTHFAEQIAAVRGRTAARDGRRVVAVAAGPGLAALFEEAGAVVVPGGPGR
RPSTGQLLEAITACGASEVIVLPNDHDSVRVAQIAASTAEADADGAVRVAVIPTQAQVTG
LAAVAVHEPGRSFEQDVLEMTATARHARQGAVTIAAKQAMTMAGPCETGDALGVIAGDFA
VVGSDLYAVAVEVLDRLLGGGGELVTIVAGAEDAEGSLATRCAGYVEEHHPAVDVVVYDG
GQERYPLLMSVE
Download sequence
Identical sequences A1SLV3
gi|119717510|ref|YP_924475.1| 196162.Noca_3286 WP_011756722.1.100580 WP_011756722.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]