SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119717539|ref|YP_924504.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119717539|ref|YP_924504.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily DhaL-like 2.88e-40
Family DhaL-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119717539|ref|YP_924504.1|
Sequence length 207
Comment Dak phosphatase [Nocardioides sp. JS614]
Sequence
MNAKDLNDHIRRSLEILTESADELRDLDQALGDGDLGITITAGSHAVVAELDQLADDATP
TEIARTCAKAFANANPSTMAALVAGALLAGSRTWEGKDDIGLPEAAEFAAAAANSIAQRG
KTQVGDKTILDGIHAAAETLRSASDSGQAAAAVVDAAARAVEETRSLQSRRGRASWLQER
SIGLADPGATAFQRFVEAWSRVDGPSS
Download sequence
Identical sequences A1SLY2
gi|119717539|ref|YP_924504.1| 196162.Noca_3315 WP_011756751.1.100580 WP_011756751.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]