SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119718419|ref|YP_925384.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119718419|ref|YP_925384.1|
Domain Number 1 Region: 36-142
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000706
Family Apolipoprotein 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119718419|ref|YP_925384.1|
Sequence length 231
Comment hypothetical protein Noca_4200 [Nocardioides sp. JS614]
Sequence
MPGPHPTEGAKDMAKAKFDIKTEATRPLYAGVGVTDLAVERVREYVADVQKRFTEAQKDV
QARVKDFDFEPEALRKQTVTFVNERVEAITKDAKARRAAIEARVEELQADAKEIPGRLQH
LFDENIDSVNETYADLAKRGETLVERIRRQQSTKKTVTSAKTTSAKAKTTKTQTAKATKT
TAKKTAKKASTTARKSSTAPKSSAKATTTAAKKTAANAADATTDAASKVGD
Download sequence
Identical sequences A1SPG2
gi|119718419|ref|YP_925384.1| 196162.Noca_4200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]