SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119715013|ref|YP_921978.1| from Nocardioides sp. JS614

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119715013|ref|YP_921978.1|
Domain Number 1 Region: 1-376
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.44e-94
Family Phase 1 flagellin 0.00000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119715013|ref|YP_921978.1|
Sequence length 376
Comment flagellin domain-containing protein [Nocardioides sp. JS614]
Sequence
MSLRINQNIDALNSYRNLSVTQGQMSKSLEKLSSGYRINRAADDAAGLAISEGLRSQVGG
IKVAVRNAQDGVSVVQTAEGALTETHSILQRMRDLSVQAANDSNDVSSRAAIQSENDALV
DELDRIATSTTFNNVSLLDGNYIGKNFQVGYGTGATDSIAVDITSTGTGGAKSTWANGAA
STTAAAATFTHNGVATTTGVLVASTDANNIATQLNADANFKTNYTASVDDKGGLVVTSKD
GLPGAITVSGAGLAGAHVDAAPGANAGFSSTDLGVGALVLDSAANAKAATNAIDTAIKGV
STARAKLGAMQNRFEHTINNLSVTQENLSASESRIRDTDMAAEMMQFTRSQILSQAGTAM
LAQANQAPQGVLQLLR
Download sequence
Identical sequences A1SEQ6
196162.Noca_0766 WP_011754240.1.100580 WP_011754240.1.96005 gi|119715013|ref|YP_921978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]