SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116748465|ref|YP_845152.1| from Syntrophobacter fumaroxidans MPOB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116748465|ref|YP_845152.1|
Domain Number 1 Region: 58-124
Classification Level Classification E-value
Superfamily LCCL domain 4.58e-16
Family LCCL domain 0.0019
Further Details:      
 
Domain Number 2 Region: 167-233
Classification Level Classification E-value
Superfamily LCCL domain 0.00000000000000275
Family LCCL domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116748465|ref|YP_845152.1|
Sequence length 237
Comment LCCL domain-containing protein [Syntrophobacter fumaroxidans MPOB]
Sequence
MRKATLALGVFVLSAFLLIGHSTLEAQNVLPDPGTLNQMENVAPGTTMFFNVTGKTTGGS
LWGTDYYTTDSSLAMAAVHSGAIRNGQTGVVKVIFYPGRAQYAGSTRYGVTSSSWGSYEL
SFAVEAAEGVKPVAGNAVMPNPGTLKNVPGAAPGQVMLFEVTGTGSGGSVWGSKMYTTDS
DLGMVAVHAGVLKAGETGVVKVTFRPGQTKYVGSTKNGVKSSNWGSYDLSFEIERVK
Download sequence
Identical sequences A0LH15
335543.Sfum_1023 gi|116748465|ref|YP_845152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]