SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116749057|ref|YP_845744.1| from Syntrophobacter fumaroxidans MPOB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116749057|ref|YP_845744.1|
Domain Number 1 Region: 389-773
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 8.37e-60
Family Nitrous oxide reductase, N-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 48-405
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.43e-36
Family Di-heme elbow motif 0.015
Further Details:      
 
Domain Number 3 Region: 858-974
Classification Level Classification E-value
Superfamily Cytochrome c 3.86e-18
Family Di-heme cytochrome c peroxidase 0.0077
Further Details:      
 
Domain Number 4 Region: 744-853
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000004
Family Two-domain cytochrome c 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116749057|ref|YP_845744.1|
Sequence length 974
Comment YVTN beta-propeller repeat-containing protein [Syntrophobacter fumaroxidans MPOB]
Sequence
MSRTSRIFQLSLFPGLSLLLLFVLGASAARQGDPAEPPARAKVQATAASKAKRFYVGVAS
CRKCHDDPKGRNQFNVWYLLPHAKGYATLAMRESAQIAKLSGINIDVLTSPICLGCHSTA
SDAENWERDKGFHLEDGVQCERCHGPGSEYSDPAIMADREAAVRAGLRIPDKDYCMNCHE
EKGSHQSVLKVKPYVFETAIETISHKGRGGAVPETSKRSQPLLDGPKYVGVMVCARCHNK
STTGFAFSKWRLSSHADACVTLGSDKARQIASGAGVEGDPRQAPACLKCHVTGQGEPEGP
SLKTFEPMRGVQCESCHGPGSEYAREEVMIDKAASRRAGLNDAPGETCLRCHNGFHGKTL
EYESMWKAISHSKPDDAQNRQQAVEYKTPFNLAVTRDGRRLFVACEGSGSLIAVDTKKRA
VIAETKVQNLPHGVSLSPDEERVFVSNRGSDTVSVVDARTYKVVAAFSVGDEPHDLMSDV
SGSTLYVANAGSNDISVVSLREGREVKRLSAGRGTWGMSRSPDNRLIYVTNNLSHFVKFR
APSRSEVTVIDTGTARVRNRIVIPEANLVQGIDFSPDGEFALVTLLRTKNLVPMVRVVQG
WVITNGIGILWKDGRVDQLLLDEFDHHFADPTDVAITAKGRYAYVSGGGVNAVAAIDVER
MKEVLNRASSEERESVLPNHLGVPNDYIVKRIEVGRGPRGLVASPDGRFVYVADALDDAV
SIIDTAKQERVGVIDLGGPKEVTLERMGERIFHSAEATYGCQFSCHSCHPDGGIDGITYD
IEPDGIGINPVDNRTLRGILDTAPFKWTGKNPSLSRQCGPRLAVFFTRVDPFTPDQVKAL
DRYICSIPRNPNRYRSEDRLTPAQRRGKAIFERTHTNTGEEIPVANRCDTCHPGPYFTNR
RIVDVGTRSELDTGGKFDVPQLNNIYENAPFLHDGRADTLEEIWTRFNPEDRHGVTNDMT
KDQLNDLIEYLKTL
Download sequence
Identical sequences A0LIQ7
gi|116749057|ref|YP_845744.1| 335543.Sfum_1622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]