SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150387913|ref|YP_001317962.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150387913|ref|YP_001317962.1|
Domain Number 1 Region: 2-215
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.75e-77
Family Phosphate binding protein-like 0.0000047
Further Details:      
 
Domain Number 2 Region: 218-307
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 4.32e-29
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150387913|ref|YP_001317962.1|
Sequence length 316
Comment porphobilinogen deaminase [Alkaliphilus metalliredigens QYMF]
Sequence
MRTIKIGSRASQLALVQAEIIINMLKEKFPQYTYEIIKITTLGDRILDKTLDKIGGKGLF
VKEIQKALAEEKIDLAIHSMKDMPGETPEELVLGAITKREDPRDVLITRENKSLEELPKG
AVIGSSSLRRQAQVMALRGDIKVVPIRGNVGTRLGKIETESLDGVILAAAGLNRLGLKEK
ISSYLEIEDFTPAVGQGALGCEARRKDIEMLEMLLAINHEETYRCVMAERAFLKLLEGGC
HVPIGAYGQQQGQELHMTGMVASSDGRRVIKEQVMGDIADFQALGIQLGETLIEKGAKEI
LETVNTDNRIVNTEGS
Download sequence
Identical sequences A6TJD5
gi|150387913|ref|YP_001317962.1| WP_011971212.1.32322 293826.Amet_0060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]