SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150388387|ref|YP_001318436.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150388387|ref|YP_001318436.1|
Domain Number - Region: 152-238
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000306
Family Phosphate binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150388387|ref|YP_001318436.1|
Sequence length 344
Comment TRAP dicarboxylate transporter subunit DctP [Alkaliphilus metalliredigens QYMF]
Sequence
MKKLITMFLGTILLVSLLTACSSPATPTEGDAEDATESVQPVTIQIGYENHPGEPLDLAV
NEWKRLVEERSNGNMTVQVFPSSQLGSKNDIIDQMMAGDSVITLADGAFYADRGVPDFGI
VFGPYLFDTWEEAWKLTESDWYAGQSGLLEEKGLKLLTSNWMYGDRHTLTTNPVRTVEDL
KGMKIRVPNNTIQVKGFEVLGATPTPMALGDVYTALQQGTIDGLENPLPVLYNGKFHEVA
KYLTLDGHVRNFTTWVMGAEFFNSLTAEQQQILMETGNEAGLYNNELQEQVNEETLELFK
AEGVEIIEVDPAVFQEAAKSFYSLPEFTSIWSEGLYDTVKDAMK
Download sequence
Identical sequences A6TKQ9
WP_011971685.1.32322 gi|150388387|ref|YP_001318436.1| 293826.Amet_0550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]