SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150388395|ref|YP_001318444.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150388395|ref|YP_001318444.1|
Domain Number - Region: 155-239
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0706
Family Phosphate binding protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150388395|ref|YP_001318444.1|
Sequence length 355
Comment TRAP dicarboxylate transporter subunit DctP [Alkaliphilus metalliredigens QYMF]
Sequence
MKKLGIKLSVILVLLLLITGVLTACGGGETPAEAETEGEVTTEVESDDDYKLVLRLSHVF
SPEEQLTKSMDLVADSIYEKTNGAIEIQTFPQGQIAAYKDGVEQVVRGADFISVEDPSYI
GDYVPDFTAMVGPMLYDTYAEYVAMTDTELVADMKRRAEEKGIKILSLDYVFGFRNVITD
KVIETPADLNGVRLRVPGSQLFIETLNAMGANSTPLPWGETISAMQQGVVDGIEGSEFTN
LGNSIYEVRKNVALTRHFLGACGVYISTDVWDGIPAKYQKIIQDEYNAGAIHMVELLTEQ
HAGVVEELESYGVQFNEVDREAFVEATAHIYDTFPGLTPGIYDLLQEELAIIRGQ
Download sequence
Identical sequences A6TKR7
WP_011971693.1.32322 gi|150388395|ref|YP_001318444.1| 293826.Amet_0558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]