SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150388940|ref|YP_001318989.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150388940|ref|YP_001318989.1|
Domain Number 1 Region: 43-511
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.43e-113
Family Phosphate binding protein-like 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150388940|ref|YP_001318989.1|
Sequence length 518
Comment extracellular solute-binding protein [Alkaliphilus metalliredigens QYMF]
Sequence
MKKKLVVLLVCMFLASLLTACIGGNETQGTTTDGNNGQESSTEEKILTFGSTESTTSLDP
HMDWNGWYGVRYGITETLFKLNDSLVPEPWLAESYENIDGLTWKIILKDNVFFTNGEAVT
AHKVVENMQRFGEVNYRAAVFATASYTVEDDLTILIKTEAPYATLINDLSDPYASIIDLA
TTEDRETHPIGTGPYISVEFLPDESVTLEKNQSYWDGTPKLDKVYVKKISDMDTLAMALQ
SGEIDVAHNITSDTVELFKDTSKYTVSQVETSRAYMLYYNLETLPDEAVRKAISMAIDKE
SICTYLLNNSATPAVGAFPDRMVYGGSNLKGVAYDSEGAKAILEQAGYRDLNGDGIREKD
GEPLSINLVLYRRLSQEDIATEMQSALKQIGIDVNVTVFDNTEYFKTGEFDIGMYCIVTS
PTGDSDAFLNMTMRTGMDNNFGGYSHSKVDDLLEQLQQEYDPDKRAELTIEIQQLVLDDY
AYDFIGFNNMTMIMKKNVTGFKAHPTDYYQLNVNSDIQ
Download sequence
Identical sequences A6TMB2
293826.Amet_1119 gi|150388940|ref|YP_001318989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]