SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150389501|ref|YP_001319550.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150389501|ref|YP_001319550.1|
Domain Number 1 Region: 348-828
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.44e-105
Family Phosphate binding protein-like 0.00000891
Further Details:      
 
Domain Number 2 Region: 50-334
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.83e-62
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150389501|ref|YP_001319550.1|
Sequence length 830
Comment methyl-accepting chemotaxis sensory transducer [Alkaliphilus metalliredigens QYMF]
Sequence
MIFFKNKNQTQETMEPRENKQEKREELQKKETMKKIKGQSERQQQANDRVSTGVEQVENT
MVQMLDIIKEIAEEAEKQSFYLEKSIEIVNESAAFSQQVAVSTSQAGEISTNALATAQKG
KKAVDSTIECMHTIKDSVDNVQNVVIELESRSKKIENIVGTIKEIAKQTNLLALNAAIEA
ARAGEHGRGFAVVAGEVKKLAEKSASSSEEISTIILEIQGKTMESINAMKASSHVVVQGV
DIAKETEKTIEEIVSAVDVSHTVTSEINEASHKQADNIEFLIQTIDDMEKAAHRVLNLTE
TATMDTQYQKSSVRYLKSLTQQLNEISQRGIETIANFTKGIEAEATKLNFLNIGKPKDFD
PAMAIDLASINVLANMHIGLVKFGEDTDIVPSAAKSWHLENDGVTWSFLLKQGVRFHNGK
ELKARHFKSSIERILNPKTYSPNAWLFEMIVGAKELMGGERNEAIGIKIMDDYRLSITLE
KPYHSFILNLGQTASSIVDVDGEQVVGAGPYYIQKREEHSCTLKAFEGYYEGKAFVDEVK
VIYEEANNSQAFEEKEIDLMGVNHGAYQYIRKLPEHKDRVCIDEGYGTYYVGFNLKSNNP
LVQSKKVRQAINYSVHKGHLIDEVTGGLATEAQGPIPPTIIDDRTLKGYPYDINKGKSLF
AETEFKGQQKGQLNLHYIQSAGDNTYELIAKSIQRQLQEIGIDVKLMPQNNQEYLTPRGY
ETCDIFVYRWIGDTGDPDNFLQPMFNINNPTDFTRYHNPQVDAGLEEAMAIKNPSKRQEK
YCEIQRMIVEDAPWIFLYHMTNNYIYQPYVKGAKIHPIGFYRFNHIWLDQ
Download sequence
Identical sequences A6TNX3
gi|150389501|ref|YP_001319550.1| 293826.Amet_1715 WP_012062929.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]