SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150389522|ref|YP_001319571.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150389522|ref|YP_001319571.1|
Domain Number 1 Region: 19-437
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.68e-67
Family Phosphate binding protein-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150389522|ref|YP_001319571.1|
Sequence length 442
Comment extracellular solute-binding protein [Alkaliphilus metalliredigens QYMF]
Sequence
MKKIVSMVLCALMMVVLIGCSNNDTNEVASGGNQDENGEEIQEVVELEFWHALSDENGDV
LQNLIDQFNNENEFIHVNAYFQGHYRDLFEKLNGAAQANTLPTITMIYNNRLTAYVMNDF
AEDLGPYIYDSEKGMDSAVWEDIPLGLRNDGMWDGKHYSLPFNKGSYLMFYNVDALEAEG
LKVPTTWDQLENAARVLSKDGKTGLVLNQSAGIDFSFWVEQAGGHIYDEELEVPSIDSEG
VKVAYEFITGMVEEGIAQLAGEDNYITGPMSRGESFIGFASSSNLPRMEEASRETGVNWA
VAELPSGKREAALFSGTDITMFNTSTQEQKDAAWEFIKFWYQTDITTKWGMESGYIPLTY
AGAEHPEFKSYLEKDPSKIPAIGQLSAAYQDPNGLNGYAIHSNMQTALEEILAGVKTIDE
ALETAQENATREMEEAKRNFAQ
Download sequence
Identical sequences A6TNZ4
gi|150389522|ref|YP_001319571.1| WP_012062950.1.32322 293826.Amet_1736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]