SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150390870|ref|YP_001320919.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150390870|ref|YP_001320919.1|
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000636
Family Hypothetical protein PH1932 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150390870|ref|YP_001320919.1|
Sequence length 171
Comment hypothetical protein Amet_3121 [Alkaliphilus metalliredigens QYMF]
Sequence
MLSKTSRQLAIFHIFLCSTVIEVADIKHFIKTSPKTILRDIKELKNAGLIDVKFSRKEKG
YIHKDNGNHCPFSVPVFSDNKAKNMHLEKLIRLATIMIGLRYHTEKPYYEDDSENQETCS
SWYKNKFPNVSSRTRQRDFEELKKIEYCVEYDLYDKYYLVSFPMGLDDFRI
Download sequence
Identical sequences A6TSU2
293826.Amet_3121 WP_012064226.1.32322 gi|150390870|ref|YP_001320919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]