SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150390963|ref|YP_001321012.1| from Alkaliphilus metalliredigens QYMF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150390963|ref|YP_001321012.1|
Domain Number 1 Region: 90-308
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.15e-31
Family Phosphate binding protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-20
Family LysR-like transcriptional regulators 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150390963|ref|YP_001321012.1|
Sequence length 312
Comment LysR family transcriptional regulator [Alkaliphilus metalliredigens QYMF]
Sequence
MNQRELLYIKAIADTKSISKAAKKLFIAQPSLSQSIQKIEEDLGLHLFKRTNQGMLLTYA
GEKYYLAATQILKIYNDFEMEISYINDLKSGRITIGITNFLATHLLPTVLPDFKKLCPNI
QVLIQEKNSTELENTLINGEIDFAIMHMPVTKRQSSLLFDPIDDDPFLLATEKNHPLSRH
AKNIDGLSFPSIDLKLFKDEPFIVLHSGKRIGQVATMIFQKADIIPNIVLTLKNFETARR
LASTGIGSTFIPYEYSKIFGEKYQPSYFYIDQKYGAYWTTCIATSKNMYVSKASKLFIDL
VKTKFGNEKSPS
Download sequence
Identical sequences A6TT35
gi|150390963|ref|YP_001321012.1| WP_012064318.1.32322 293826.Amet_3215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]